PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009783967.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family bZIP
Protein Properties Length: 199aa    MW: 23732 Da    PI: 8.6672
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009783967.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_1439.7e-1457116362
                     XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
          bZIP_1   3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklkse 62 
                     +lk+ rr  +NR++A+rsR +K ++i eLe+kvk L+     L  e+e++k++ + l+++
  XP_009783967.1  57 DLKKLRRTVSNRLSAQRSRIKKTEYITELEKKVKDLQDTIAYLSPEIENYKEKQSMLRMQ 116
                     79**************************************************98887765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003388.5E-855119IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.36957120IPR004827Basic-leucine zipper domain
PfamPF001707.6E-1358116IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.21E-1158114No hitNo description
Gene3DG3DSA:1.20.5.1705.4E-1359116No hitNo description
CDDcd147034.48E-1060110No hitNo description
PROSITE patternPS0003606277IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 199 aa     Download sequence    Send to blast
MEDKRKRSEP ELALSLKSPT DNQDELSVNR RKVPLTLDQA IDFELNKLGR NVDSDVDLKK  60
LRRTVSNRLS AQRSRIKKTE YITELEKKVK DLQDTIAYLS PEIENYKEKQ SMLRMQRKYL  120
QEQLDTFTDR SKLRTVQIEE MKLELRRLKE LAKAQEEHYN MQLGQTTNYF YLSEMEQQAG  180
IDQYLNLDAM NFYPPKNEM
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009783967.11e-142PREDICTED: basic leucine zipper 19
RefseqXP_016471095.11e-142PREDICTED: basic leucine zipper 19-like
TrEMBLM1CZC98e-53M1CZC9_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000780842e-52(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA76151929
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G42380.22e-10bZIP family protein